Anti-SUR2B Antibody, IgG2b, Clone: [N323B/20], Unconjugated, Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-SUR2B Antibody, IgG2b, Clone: [N323B/20], Unconjugated, Mouse, Monoclonal
• Artikelnummer: ANI-73-399
• Hersteller Artikelnummer: 73-399
• Alternativnummer: ANI-73-399
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC, IHC, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
• Konjugation: Unconjugated
• Alternative Synonym: ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)

Produktbeschreibung

Sulfonylurea receptor 2B (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: Lot dependent
• Klon-Bezeichnung: [N323B/20]
• Molekulargewicht: 175 kDa (and smaller fragments likely due to proteolytic cleavage)
• Isotyp: IgG2b
• UniProt: Q63563
• Puffer: Supernatant is provided in cell culture medium with 0.1% sodium azide as anti-microbial
• Reinheit: TC Supernatant
• Formulierung: Liquid
• Target-Kategorie: SUR2B
• Antibody Type: Primary Antibody