Anti-GluA2/GluR2 Glutamate Receptor Antibody, IgG1, Clone: [L21/32], Unconjugated, Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-GluA2/GluR2 Glutamate Receptor Antibody, IgG1, Clone: [L21/32], Unconjugated, Mouse, Monoclonal
• Artikelnummer: ANI-75-002-020
• Hersteller Artikelnummer: 75-002-020
• Alternativnummer: ANI-75-002-020
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: EM, ICC, IHC, IP, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
• Konjugation: Unconjugated
• Alternative Synonym: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Produktbeschreibung

Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 1 mg/mL
• Klon-Bezeichnung: [L21/32]
• Molekulargewicht: 90 kDa
• Isotyp: IgG1
• UniProt: P19491
• Puffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.4
• Reinheit: Purified by Protein A chromatography
• Formulierung: Liquid
• Target-Kategorie: GluA2/GluR2 glutamate receptor
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: Dilution Range: WB: 1:500. Dilution Range: IHC: 1:250. Dilution Range: ICC: 1:500