Anti-SUR1 Antibody FL550 Conjugate, IgG1, Clone: [N289/16], Mouse, Monoclonal

Artikelnummer: ANI-75-267-FL550
Artikelname: Anti-SUR1 Antibody FL550 Conjugate, IgG1, Clone: [N289/16], Mouse, Monoclonal
Artikelnummer: ANI-75-267-FL550
Hersteller Artikelnummer: 75-267-FL550
Alternativnummer: ANI-75-267-FL550
Hersteller: Antibodies Incorporated
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Hamster, Mouse, Rat
Immunogen: Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (accession number Q09429) produced recombinantly in E. Coli
Konjugation: FL550
Alternative Synonym: ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)
Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KC
Klonalität: Monoclonal
Konzentration: 0.5 mg/mL
Klon-Bezeichnung: [N289/16]
Molekulargewicht: 180 kDa
Isotyp: IgG1
UniProt: Q09429
Puffer: PBS with 0.09% azide
Reinheit: Purified by Protein A chromatography
Formulierung: Liquid
Target-Kategorie: SUR1
Antibody Type: Primary Antibody