Anti-SUR1 Antibody FL650 Conjugate, IgG1, Clone: [N289/16], Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-SUR1 Antibody FL650 Conjugate, IgG1, Clone: [N289/16], Mouse, Monoclonal
• Artikelnummer: ANI-75-267-FL650
• Hersteller Artikelnummer: 75-267-FL650
• Alternativnummer: ANI-75-267-FL650
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC, IHC
• Spezies Reaktivität: Hamster, Mouse, Rat
• Immunogen: Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (accession number Q09429) produced recombinantly in E. Coli
• Konjugation: FL650
• Alternative Synonym: ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)

Produktbeschreibung

Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KC

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 0.5 mg/mL
• Klon-Bezeichnung: [N289/16]
• Molekulargewicht: 180 kDa
• Isotyp: IgG1
• UniProt: Q09429
• Puffer: PBS with 0.09% azide
• Reinheit: Purified by Protein A chromatography
• Formulierung: Liquid
• Target-Kategorie: SUR1
• Antibody Type: Primary Antibody