Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli
Konjugation:
Unconjugated
Alternative Synonym:
ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Sulfonylurea receptor 2A (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR