Anti-SUR2A Antibody, IgG2a, Clone: [N319A/14], Unconjugated, Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-SUR2A Antibody, IgG2a, Clone: [N319A/14], Unconjugated, Mouse, Monoclonal
• Artikelnummer: ANI-75-296
• Hersteller Artikelnummer: 75-296
• Alternativnummer: ANI-75-296
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC, IHC, WB
• Spezies Reaktivität: Rat and Mouse
• Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli
• Konjugation: Unconjugated
• Alternative Synonym: ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)

Produktbeschreibung

Sulfonylurea receptor 2A (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR

Zusatzinformationen

SUR2A, IgG2a, Clone: N319A/14, Mouse, Monoclonal

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 1 mg/mL
• Klon-Bezeichnung: [N319A/14]
• Molekulargewicht: 120 kDa
• Isotyp: IgG2a
• UniProt: P70170
• Puffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
• Reinheit: Purified by Protein A chromatography
• Formulierung: Liquid
• Target-Kategorie: SUR2A
• Antibody Type: Primary Antibody