Anti-SUR2A Antibody FL550 Conjugate, IgG2a, Clone: [N319A/14], Mouse, Monoclonal

Artikelnummer: ANI-75-296-FL550
Artikelname: Anti-SUR2A Antibody FL550 Conjugate, IgG2a, Clone: [N319A/14], Mouse, Monoclonal
Artikelnummer: ANI-75-296-FL550
Hersteller Artikelnummer: 75-296-FL550
Alternativnummer: ANI-75-296-FL550
Hersteller: Antibodies Incorporated
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Rat and Mouse
Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli
Konjugation: FL550
Alternative Synonym: ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Sulfonylurea receptor 2A (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR
Klonalität: Monoclonal
Konzentration: 0.5 mg/mL
Klon-Bezeichnung: [N319A/14]
Molekulargewicht: 120 kDa
Isotyp: IgG2a
UniProt: P70170
Puffer: PBS with 0.09% azide
Reinheit: Purified by Protein A chromatography
Formulierung: Liquid
Target-Kategorie: SUR2A
Antibody Type: Primary Antibody