Anti-BAF53b Antibody, IgG1, Clone: [N332B/15], Unconjugated, Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-BAF53b Antibody, IgG1, Clone: [N332B/15], Unconjugated, Mouse, Monoclonal
• Artikelnummer: ANI-75-311
• Hersteller Artikelnummer: 75-311
• Alternativnummer: ANI-75-311
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC, IHC, WB
• Spezies Reaktivität: Human
• Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
• Konjugation: Unconjugated
• Alternative Synonym: Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)

Produktbeschreibung

Actin Like 6B, of BAFcomplex 53 KDa Subunit (BAF53b) is encoded by the gene ACTL6B and is a member of actin-related proteins family. It is a subunit of the neuron specific chromatin remodeling complex (nBAF complex). ACTL6B plays a role in remodeling mon

Zusatzinformationen

BAF53b, IgG1, Clone: N332B/15, Mouse, Monoclonal

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 1 mg/mL
• Klon-Bezeichnung: [N332B/15]
• Molekulargewicht: 53 kDa
• Isotyp: IgG1
• UniProt: O94805
• Puffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
• Reinheit: Purified by Protein A chromatography
• Formulierung: Liquid
• Target-Kategorie: BAF53b
• Antibody Type: Primary Antibody