Anti-REEP1 Antibody FL490 Conjugate, IgG2b, Clone: [N345/51], Mouse, Monoclonal

Artikelnummer: ANI-75-313-FL490
Artikelname: Anti-REEP1 Antibody FL490 Conjugate, IgG2b, Clone: [N345/51], Mouse, Monoclonal
Artikelnummer: ANI-75-313-FL490
Hersteller Artikelnummer: 75-313-FL490
Alternativnummer: ANI-75-313-FL490
Hersteller: Antibodies Incorporated
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Rat and Mouse
Immunogen: Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
Konjugation: FL490
Alternative Synonym: Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
Receptor expression-enhancing protein 1, Receptor Accessory Protein 1 or REEP1 is encoded by the gene REEP1. The REEP protein family is made up of six REEP proteins 1-6. REEP1 is a mitochondrial protein that links ER tubules to the cytoskeleton and is in
Klonalität: Monoclonal
Konzentration: 0.5 mg/mL
Klon-Bezeichnung: [N345/51]
Molekulargewicht: 22 kDa
Isotyp: IgG2b
UniProt: Q8BGH4
Puffer: PBS with 0.09% azide
Reinheit: Purified by Protein A chromatography
Formulierung: Liquid
Target-Kategorie: REEP1
Antibody Type: Primary Antibody