Anti-Kv1.2 Potassium Channel Subunit Antibody FL650 Conjugate, IgG2a, Clone: [L76/36], Mouse, Monoclonal

Artikelnummer: ANI-75-314-FL650
Artikelname: Anti-Kv1.2 Potassium Channel Subunit Antibody FL650 Conjugate, IgG2a, Clone: [L76/36], Mouse, Monoclonal
Artikelnummer: ANI-75-314-FL650
Hersteller Artikelnummer: 75-314-FL650
Alternativnummer: ANI-75-314-FL650
Hersteller: Antibodies Incorporated
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (accession number P16389) produced recombinantly in E. Coli
Konjugation: FL650
Alternative Synonym: Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)
Potassium voltage-gated channel subfamily A member 2 (also known as Potassium Voltage-Gated Channel A Member 2 , Shaker-Related Subfamily, Member 2 or Voltage-Gated Potassium Channel Protein Kv1.2, or KCNA2) is a member of the Kv family of potassium chan
Klonalität: Monoclonal
Konzentration: 0.5 mg/mL
Klon-Bezeichnung: [L76/36]
Molekulargewicht: 80 kDa
Isotyp: IgG2a
UniProt: P16389
Puffer: PBS with 0.09% azide
Reinheit: Purified by Protein A chromatography
Formulierung: Liquid
Target-Kategorie: Kv1.2 potassium channel subunit
Antibody Type: Primary Antibody