Anti-SVOP Antibody FL490 Conjugate, IgG1, Clone: [N356/23], Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-SVOP Antibody FL490 Conjugate, IgG1, Clone: [N356/23], Mouse, Monoclonal
• Artikelnummer: ANI-75-353-FL490
• Hersteller Artikelnummer: 75-353-FL490
• Alternativnummer: ANI-75-353-FL490
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC
• Spezies Reaktivität: Rat and Mouse
• Immunogen: Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (accession number Q9Z2I7) produced recombinantly in E. Coli
• Konjugation: FL490
• Alternative Synonym: Synaptic vesicle 2-related protein (SV2-related protein)

Produktbeschreibung

Synaptic vesicle 2-related protein or SVOP is encoded by the gene SVOP. SVOP contains 12 transmembrane regions and has transporter and ion transmembrane transporter activity. SVOP is expressed early in development and expressed in brain and endocrine cel

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 0.5 mg/mL
• Klon-Bezeichnung: [N356/23]
• Molekulargewicht: 60 kDa
• Isotyp: IgG1
• UniProt: Q9Z2I7
• Puffer: PBS with 0.09% azide
• Reinheit: Purified by Protein A chromatography
• Formulierung: Liquid
• Target-Kategorie: SVOP
• Antibody Type: Primary Antibody