Anti-Kir6.2 Potassium Channel Antibody FL490 Conjugate, IgG1, Clone: [N363/71], Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-Kir6.2 Potassium Channel Antibody FL490 Conjugate, IgG1, Clone: [N363/71], Mouse, Monoclonal
• Artikelnummer: ANI-75-393-FL490
• Hersteller Artikelnummer: 75-393-FL490
• Alternativnummer: ANI-75-393-FL490
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC, IHC
• Spezies Reaktivität: Rat and Mouse
• Immunogen: Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS, cytoplasmic C-terminus) of rat Kir6.2 (accession number P70673) produced recombinantly in E. Coli
• Konjugation: FL490
• Alternative Synonym: ATP-sensitive inward rectifier potassium channel 11 (BIR) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11)

Produktbeschreibung

ATP-sensitive inward rectifier potassium channel 11 or Kir6.2 is encoded by the gene KCNJ11. Kir6.2 is an integral membrane protein which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 0.5 mg/mL
• Klon-Bezeichnung: [N363/71]
• Molekulargewicht: 45 kDa
• Isotyp: IgG1
• UniProt: P70673
• Puffer: PBS with 0.09% azide
• Reinheit: Purified by Protein A chromatography
• Formulierung: Liquid
• Target-Kategorie: Kir6.2 potassium channel
• Antibody Type: Primary Antibody