RUVBL2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ASB-OAAN00599
Artikelname: RUVBL2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ASB-OAAN00599
Hersteller Artikelnummer: OAAN00599
Alternativnummer: ASB-OAAN00599-100UL,ASB-OAAN00599-200UL,ASB-OAAN00599-50UL
Hersteller: Aviva
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-463 of human RUVBL2 (NP_006657.1).
Konjugation: Unconjugated
Alternative Synonym: RVB2, TIH2, ECP51, TIP48, CGI-46, ECP-51, INO80J, REPTIN, TIP49B, TAP54-beta
This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase
Klonalität: Polyclonal
Molekulargewicht: 51 kDa
NCBI: 10856
UniProt: Q9Y230
Formulierung: Liquid PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Sequenz: MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRT
Immunofluorescence analysis of U20S cell using RUVBL2 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of MCF-7 cell using RUVBL2 antibody. Blue: DAPI for nuclear staining.
Western blot analysis of extracts of various cell lines, us