TREX1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ASB-OAAN02009
Artikelname: TREX1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ASB-OAAN02009
Hersteller Artikelnummer: OAAN02009
Alternativnummer: ASB-OAAN02009-100UL,ASB-OAAN02009-200UL,ASB-OAAN02009-50UL
Hersteller: Aviva
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human TREX1 (NP_057465.1).
Konjugation: Unconjugated
Alternative Synonym: CRV, AGS1, DRN3, HERNS, RVCLS
This gene encodes a nuclear protein with 3 exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree
Klonalität: Polyclonal
Molekulargewicht: 33 kDa
NCBI: 11277
UniProt: Q9NSU2
Formulierung: LiquidPBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Sequenz: MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLGSIYTRLYGQSPPDSHTAEG
Immunofluorescence analysis of A549 cell using TREX1 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cell using TREX1 antibody.
Western blot analysis of extracts of various cell lines, using TREX1 antibody.