ICT1 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02228
Artikelname: ICT1 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02228
Hersteller Artikelnummer: OPCA02228
Alternativnummer: ASB-OPCA02228-100UG,ASB-OPCA02228-1MG,ASB-OPCA02228-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: 39S ribosomal protein L58, mitochondrial,digestion substraction 1,DS1,DS-1,ICT1,immature colon carcinoma transcript 1 protein,mitochondrial large ribosomal subunit protein ICT1,mitochondrial large ribosomal subunit protein mL62,MRP-L58,peptidyl-tRNA hydr
Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibl
Molekulargewicht: 36.4 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 3396
UniProt: Q14197
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD