SEPT7 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02249
Artikelname: SEPT7 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02249
Hersteller Artikelnummer: OPCA02249
Alternativnummer: ASB-OPCA02249-100UG,ASB-OPCA02249-1MG,ASB-OPCA02249-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: CDC10,CDC10 (cell division cycle 10, S. cerevisiae, homolog),CDC10 protein homolog,CDC3,NBLA02942,SEPT7,SEPT7A,septin 7 variant 4,septin-7.
Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Required for normal progress through mitosis. Involved in cytokinesis. Required for normal association of CENPE with the kinetochore. Plays a role in ciliog
Molekulargewicht: 66.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 989
UniProt: Q16181
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTII