COTL1 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02255
Artikelname: COTL1 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02255
Hersteller Artikelnummer: OPCA02255
Alternativnummer: ASB-OPCA02255-100UG,ASB-OPCA02255-1MG,ASB-OPCA02255-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: CLP,coactosin-like 1,coactosin-like protein,epididymis secretory sperm binding protein.
Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Acts as a chaperone for ALOX5 (5LO), influencing both its stability and activity in leukotrienes synthesis.
Molekulargewicht: 31.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 23406
UniProt: Q14019
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE