GCKR Recombinant Protein, Human

Artikelnummer: ASB-OPCA02256
Artikelname: GCKR Recombinant Protein, Human
Artikelnummer: ASB-OPCA02256
Hersteller Artikelnummer: OPCA02256
Alternativnummer: ASB-OPCA02256-100UG,ASB-OPCA02256-1MG,ASB-OPCA02256-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: FGQTL5,GKRP,glucokinase (hexokinase 4) regulator,glucokinase regulatory protein,hexokinase 4 regulator.
Inhibits glucokinase (GCK) by forming an inactive complex with this enzyme. The affinity of GCKR for GCK is modulated by fructose metabolites: GCKR with bound fructose 6-phosphate has increased affinity for GCK, while GCKR with bound fructose 1-phosphate
Molekulargewicht: 84.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 2646
UniProt: Q14397
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEIFQEEGQALSTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDCCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGL