INPP5A Recombinant Protein, Human

Artikelnummer: ASB-OPCA02257
Artikelname: INPP5A Recombinant Protein, Human
Artikelnummer: ASB-OPCA02257
Hersteller Artikelnummer: OPCA02257
Alternativnummer: ASB-OPCA02257-100UG,ASB-OPCA02257-1MG,ASB-OPCA02257-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: 43 kDa inositol polyphosphate 5-phophatase,43 kDa inositol polyphosphate 5-phosphatase,5PTASE,CTCL tumor antigen HD-CL-02,inositol polyphosphate-5-phosphatase A,inositol polyphosphate-5-phosphatase, 40kD,inositol polyphosphate-5-phosphatase, 40kDa,inosit
Major isoenzyme hydrolyzing the calcium-mobilizing second messenger Ins(1,4,5)P3, this is a signal-terminating reaction.
Molekulargewicht: 63.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 3632
UniProt: Q14642
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQT