PLA2R1 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02261
Artikelname: PLA2R1 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02261
Hersteller Artikelnummer: OPCA02261
Alternativnummer: ASB-OPCA02261-100UG,ASB-OPCA02261-1MG,ASB-OPCA02261-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: 180 kDa secretory phospholipase A2 receptor,CLEC13C,C-type lectin domain family 13 member C,M-type receptor,phospholipase A2 receptor 1, 180kD,phospholipase A2 receptor 1, 180kDa,PLA2G1R,PLA2IR,PLA2R,PLA2-R,secretory phospholipase A2 receptor.
Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor p
Molekulargewicht: 19.4 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 22925
UniProt: Q13018
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID