MFAP5 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02262
Artikelname: MFAP5 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02262
Hersteller Artikelnummer: OPCA02262
Alternativnummer: ASB-OPCA02262-100UG,ASB-OPCA02262-1MG,ASB-OPCA02262-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: AAT9,MAGP2,MAGP-2,MFAP-5,Microfibril-associated glycoprotein 2,microfibril-associated glycoprotein-2,microfibrillar associated protein 5,microfibrillar-associated protein 5,MP25,THE1A-MFAP5.
May play a role in hematopoiesis. In the cardiovascular system, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity (By similarity). Component of the elastin-associated microfibrils (PubMed:8557636).
Molekulargewicht: 33.3 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 8076
UniProt: Q13361
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL