ARHGAP19 Recombinant Protein, Human

Produktübersicht

• Artikelname: ARHGAP19 Recombinant Protein, Human
• Artikelnummer: ASB-OPCA02265
• Hersteller Artikelnummer: OPCA02265
• Alternativnummer: ASB-OPCA02265-100UG,ASB-OPCA02265-1MG,ASB-OPCA02265-20UG
• Hersteller: Aviva
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: BAF47,BRG1-associated factor 47,CSS3,hSNF5,hSNFS,INI1,integrase interactor 1 protein,malignant rhabdoid tumor suppressor,MRD15,PPP1R144,protein phosphatase 1, regulatory subunit 144,RDT,RTPS1,Sfh1p,SNF5,SNF5 homolog,SNF5L1,Snr1,sucrose nonfermenting, yea

Produktbeschreibung

Core component of the BAF (hSWI/SNF) complex. This ATP-dependent chromatin-remodeling complex plays important roles in cell proliferation and differentiation, in cellular antiviral activities and inhibition of tumor formation. The BAF complex is able to

Produkteigenschaften

• Molekulargewicht: 60.1 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• NCBI: 6598
• UniProt: Q12824
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSIL