SART3 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02266
Artikelname: SART3 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02266
Hersteller Artikelnummer: OPCA02266
Alternativnummer: ASB-OPCA02266-100UG,ASB-OPCA02266-1MG,ASB-OPCA02266-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: DSAP1,HIV-1 Tat-interacting protein of 110kDa,hSART-3,P100,p110,p110 nuclear RNA-binding protein,p110(nrb),PRP24 homolog,RP11-13G14,SART-3,squamous cell carcinoma antigen recognized by T cells 3,squamous cell carcinoma antigen recognized by T-cells 3,tat
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation (PubMed:12032085). Also binds U6atac snRNPs a
Molekulargewicht: 49.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 9733
UniProt: Q15020
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQ