TAF12 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02270
Artikelname: TAF12 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02270
Hersteller Artikelnummer: OPCA02270
Alternativnummer: ASB-OPCA02270-100UG,ASB-OPCA02270-1MG,ASB-OPCA02270-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa,TAF2J,TAFII20,TAFII20/TAFII15,TAFII-20/TAFII-15,TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD,transcription initiation factor TFIID 20/15 kDa
TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.
Molekulargewicht: 33.9 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 6883
UniProt: Q16514
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK