ESRG Recombinant Protein, Human

Produktübersicht

• Artikelname: ESRG Recombinant Protein, Human
• Artikelnummer: ASB-OPCA02271
• Hersteller Artikelnummer: OPCA02271
• Alternativnummer: ASB-OPCA02271-100UG,ASB-OPCA02271-1MG,ASB-OPCA02271-20UG
• Hersteller: Aviva
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: ESRG, HESRG, Embryonic stem cell-related gene protein, hES cell-related gene protein

Produkteigenschaften

• Molekulargewicht: 28.2 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q1W209
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSVRKIHLRPQVLRPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNFNSFHSLVETKETCFIREPKTPAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPLAASPAFLGQGQVPLNPFSFTLSGKSRFSGAGASTPQPLLLHP