CLVS2 Recombinant Protein, Human

Produktübersicht

• Artikelname: CLVS2 Recombinant Protein, Human
• Artikelnummer: ASB-OPCA02291
• Hersteller Artikelnummer: OPCA02291
• Alternativnummer: ASB-OPCA02291-100UG,ASB-OPCA02291-1MG,ASB-OPCA02291-20UG
• Hersteller: Aviva
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: bA160A10.4,C6orf212,C6orf213,clathrin vesicle-associated Sec14 protein 2,clavesin-2,retinaldehyde binding protein 1-like 2,Retinaldehyde-binding protein 1-like 2,RLBP1L2.

Produktbeschreibung

Required for normal morphology of late endosomes and/or lysosomes in neurons (By similarity). Binds phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).

Produkteigenschaften

• Molekulargewicht: 54 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• NCBI: 134829
• UniProt: Q5SYC1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLP