NXNL2 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02299
Artikelname: NXNL2 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02299
Hersteller Artikelnummer: OPCA02299
Alternativnummer: ASB-OPCA02299-100UG,ASB-OPCA02299-1MG,ASB-OPCA02299-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: C9orf121,nucleoredoxin-like protein 2,RDCVF2,RdCVF2L,rod-derived cone viability factor 2.
May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons.
Molekulargewicht: 30.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 158046
UniProt: Q5VZ03
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS