BEND3 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02302
Artikelname: BEND3 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02302
Hersteller Artikelnummer: OPCA02302
Alternativnummer: ASB-OPCA02302-100UG,ASB-OPCA02302-1MG,ASB-OPCA02302-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: BEN domain-containing protein 3,KIAA1553.
Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its
Molekulargewicht: 42.5 kDa
Tag: N-terminal GST-tagged
NCBI: 57673
UniProt: Q5T5X7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD