Trim21 Recombinant Protein, Mouse

Artikelnummer: ASB-OPCA02306
Artikelname: Trim21 Recombinant Protein, Mouse
Artikelnummer: ASB-OPCA02306
Hersteller Artikelnummer: OPCA02306
Alternativnummer: ASB-OPCA02306-100UG,ASB-OPCA02306-1MG,ASB-OPCA02306-20UG
Hersteller: Aviva
Wirt: Mouse
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Alternative Synonym: 52 kDa ribonucleoprotein autoantigen Ro/SS-A,52 kDa Ro protein,RING-type E3 ubiquitin transferase TRIM21,Ro(SS-A),Sjoegren syndrome type A antigen,Tripartite motif-containing protein 21.
E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its s
Molekulargewicht: 70.2 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q62191
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized 10mM Tris-HCl, 1mM EDTA, 6% Trehalose (pH 8.0)
Sequenz: Full Length: MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELIS