LARP1B Recombinant Protein, Human

Artikelnummer: ASB-OPCA02307
Artikelname: LARP1B Recombinant Protein, Human
Artikelnummer: ASB-OPCA02307
Hersteller Artikelnummer: OPCA02307
Alternativnummer: ASB-OPCA02307-100UG,ASB-OPCA02307-1MG,ASB-OPCA02307-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: La ribonucleoprotein domain family member 1B,La ribonucleoprotein domain family member 2,La ribonucleoprotein domain family, member 2,la-related protein 1B,la-related protein 2,LARP2.
This gene encodes a protein containing domains found in the La related protein of Drosophila melanogaster. La motif-containing proteins are thought to be RNA-binding proteins, where the La motif and adjacent amino acids fold into an RNA recognition motif
Molekulargewicht: 40.1 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 55132
UniProt: Q659C4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE