DUSP13 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02309
Artikelname: DUSP13 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02309
Hersteller Artikelnummer: OPCA02309
Alternativnummer: ASB-OPCA02309-100UG,ASB-OPCA02309-1MG,ASB-OPCA02309-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: BEDP,branching-enzyme interacting DSP,branching-enzyme interacting dual-specificity protein phosphatase,dual specificity protein phosphatase 13,DUSP13A,DUSP13B,MDSP,muscle-restricted DSP,SKRP4,testis- and skeletal-muscle-specific DSP,TMDP.
Probable protein tyrosine phosphatase. Has phosphatase activity with synthetic substrates (PubMed:15252030, PubMed:29106959). Has a phosphatase activity-independent regulatory role in MAP3K5/ASK1-mediated apoptosis, preventing MAP3K5/ASK1 inhibition by A
Molekulargewicht: 36.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 51207
UniProt: Q6B8I1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS