CIAPIN1 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02310
Artikelname: CIAPIN1 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02310
Hersteller Artikelnummer: OPCA02310
Alternativnummer: ASB-OPCA02310-100UG,ASB-OPCA02310-1MG,ASB-OPCA02310-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: anamorsin,CIAE2,Cytokine-induced apoptosis inhibitor 1,DRE2,fe-S cluster assembly protein DRE2 homolog,predicted protein of HQ0915,PRO0915.
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the
Molekulargewicht: 49.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 57019
UniProt: Q6FI81
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLA