CCBL Recombinant Protein, Human

Artikelnummer: ASB-OPCA02314
Artikelname: CCBL Recombinant Protein, Human
Artikelnummer: ASB-OPCA02314
Hersteller Artikelnummer: OPCA02314
Alternativnummer: ASB-OPCA02314-100UG,ASB-OPCA02314-1MG,ASB-OPCA02314-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: CCBL2,cysteine-S-conjugate beta-lyase 2,KAT3,KATIII,Kynurenine aminotransferase 3,kynurenine aminotransferase III,kynurenine--glyoxylate transaminase,kynurenine--oxoglutarate transaminase 3,kynurenine--oxoglutarate transaminase III.
Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bon
Molekulargewicht: 67.4 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 56267
UniProt: Q6YP21
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVY