Anti-SOX11, IgG2a, Clone: [CL0143], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90502
Artikelname: Anti-SOX11, IgG2a, Clone: [CL0143], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90502
Hersteller Artikelnummer: AMAb90502
Alternativnummer: ATA-AMAB90502-100,ATA-AMAB90502-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
SRY (sex determining region Y)-box 11
Anti-SOX11
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0143]
Isotyp: IgG2a
NCBI: 6664
UniProt: P35716
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SOX11
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human mantle cell lymphoma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemical staining of human chronic lymphocytic leukemia shows no nuclear positivity in tumor cells as expected.
Lane 1: Marker [kDa]
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: SOX11 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418895)
AMAb90502
AMAb90502
AMAb90502