Anti-CD45, IgG2a, Clone: [CL0160], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90519
Artikelname: |
Anti-CD45, IgG2a, Clone: [CL0160], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB90519 |
Hersteller Artikelnummer: |
AMAb90519 |
Alternativnummer: |
ATA-AMAB90519-100,ATA-AMAB90519-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
PTPRC, GP180, LCA, T200, Pan-Cancer |
protein tyrosine phosphatase, receptor type C |
Klonalität: |
Monoclonal |
Konzentration: |
0.8 |
Klon-Bezeichnung: |
[CL0160] |
Isotyp: |
IgG2a |
NCBI: |
5788 |
UniProt: |
P08575 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
PTPRC |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
Immunohistochemical staining of human tonsil shows strong positivity in a majority of lymphoid cells |
|
Immunohistochemical staining of human appendix shows strong positivity in lymphoid cells but no positivity in glandular cells. |
|
Lane 1: Marker [kDa] Lane 2: Human cell line Jurkat Lane 3: Human cell line MCF-7 |
|
AMAb90519 |
|
|
|
AMAb90519 |
|
AMAb90519 |