Anti-TG, IgG2b, Clone: [CL0164], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90523
Artikelname: Anti-TG, IgG2b, Clone: [CL0164], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90523
Hersteller Artikelnummer: AMAb90523
Alternativnummer: ATA-AMAB90523-100,ATA-AMAB90523-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AITD3, TGN, Pan-Cancer
thyroglobulin
Anti-TG
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0164]
Isotyp: IgG2b
NCBI: 7038
UniProt: P01266
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: KMCSADYADLLQTFQVFILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TG
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity.
Immunohistochemical staining of human thyroid cancer shows strong cytoplasmic positivity.
Immunohistochemical staining of human small intestine shows no positivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human thyroid tissue lysate
AMAb90523
AMAb90523
AMAb90523