Anti-STX7, IgG1, Clone: [CL0257], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90616
Artikelname: Anti-STX7, IgG1, Clone: [CL0257], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90616
Hersteller Artikelnummer: AMAb90616
Alternativnummer: ATA-AMAB90616-100,ATA-AMAB90616-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: STX7
syntaxin 7
Anti-STX7
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0257]
Isotyp: IgG1
NCBI: 8417
UniProt: O15400
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: GVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: STX7
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human melanoma shows strong cytoplasmic and membrane positivity in tumour cells.
Immunohistochemical staining of human melanoma shows strong cytoplasmic positivity in tumour cells.
Immunohistochemical staining of human lymph node shows strong membrane positivity in non-germinal center cells.
Lane 1: Marker [kDa]
Lane 2: Human tonsil tissue lysate
AMAb90616
AMAb90616
AMAb90616