Anti-HER2, IgG1, Clone: [CL0268], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90627
- Bilder (7)
| Artikelname: | Anti-HER2, IgG1, Clone: [CL0268], Mouse, Monoclonal |
| Artikelnummer: | ATA-AMAB90627 |
| Hersteller Artikelnummer: | AMAb90627 |
| Alternativnummer: | ATA-AMAB90627-100,ATA-AMAB90627-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ERBB2, CD340, HER-2, NEU, NGL, Pan-Cancer |
| v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) |
| Anti-HER2 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL0268] |
| Isotyp: | IgG1 |
| NCBI: | 2064 |
| UniProt: | P04626 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HER2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human HER2-positive breast cancer shows strong membranous positivity in tumor cells. |
|
|
Immunohistochemical staining of human HER2-negative breast cancer shows no positivity in tumor cells, as expected. |
|
|
Western blot analysis in human cell line SK-BR-3 and human cell line MCF-7. |
|
|
AMAb90627 |
|
|
|
|
|
AMAb90627 |
|
|
AMAb90627 |
Produktgarantie und fachkundiger Support
