Anti-CA12, IgG1, Clone: [CL0280], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90639
Artikelname: Anti-CA12, IgG1, Clone: [CL0280], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90639
Hersteller Artikelnummer: AMAb90639
Alternativnummer: ATA-AMAB90639-100,ATA-AMAB90639-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HsT18816
carbonic anhydrase XII
Anti-CA12
Klonalität: Monoclonal
Konzentration: 0.7
Klon-Bezeichnung: [CL0280]
Isotyp: IgG1
NCBI: 771
UniProt: O43570
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CA12
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human kidney shows strong membranous and/or moderate cytoplasmic immunoreactivity in subsets of renal tubules, while glomeruli are negative.
Immunohistochemical staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.
Immunohistochemical staining of human pancreas shows strong membranous and moderate cytopalsmic positivity in the exocrine cells.
Immunohistochemical staining of human kidney (renal cancer) shows moderate immunoreactivity in cancer cells.
Lane 1: Marker [kDa]
Lane 2: Human RT-4 cell line
AMAb90639
AMAb90639
AMAb90639