Anti-SDHB, IgG2a, Clone: [CL0346], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90705
Artikelname: Anti-SDHB, IgG2a, Clone: [CL0346], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90705
Hersteller Artikelnummer: AMAb90705
Alternativnummer: ATA-AMAB90705-100,ATA-AMAB90705-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SDH, SDH1
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Anti-SDHB
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0346]
Isotyp: IgG2a
NCBI: 6390
UniProt: P21912
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SDHB
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in the hepatocytes.
Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity in renal tubuli.
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in the glandular cells.
Immunohistochemical staining of human testis shows moderate cytoplasmic immunoreactivity in the seminiferous tubules.
Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4
AMAb90705
AMAb90705
AMAb90705