Anti-MRC1, IgG2b, Clone: [CL0387], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90746
Artikelname: Anti-MRC1, IgG2b, Clone: [CL0387], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90746
Hersteller Artikelnummer: AMAb90746
Alternativnummer: ATA-AMAB90746-100,ATA-AMAB90746-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1
mannose receptor, C type 1
Anti-MRC1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0387]
Isotyp: IgG2b
NCBI: None
UniProt: P22897
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MRC1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 1 µg/ml
Immunohistochemical staining of human lung shows strong immunoreactivity in macrophages.
Immunohistochemical staining of human liver shows strong positivity in Kupffer cells.
Immunohistochemical staining of human rectum shows moderate positivity in a subset of lymphoid cells.
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human liver tissue lysate
AMAb90746
AMAb90746
AMAb90746