Anti-ATRX, IgG1, Clone: [CL0537], Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-ATRX, IgG1, Clone: [CL0537], Mouse, Monoclonal
• Artikelnummer: ATA-AMAB90784
• Hersteller Artikelnummer: AMAb90784
• Alternativnummer: ATA-AMAB90784-100,ATA-AMAB90784-25
• Hersteller: Atlas Antibodies
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC, IHC, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Konjugation: Unconjugated
• Alternative Synonym: JMS, RAD54, XH2, XNP

Produktbeschreibung

alpha thalassemia/mental retardation syndrome X-linked

Zusatzinformationen

Anti-ATRX

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 1
• Klon-Bezeichnung: [CL0537]
• Isotyp: IgG1
• NCBI: 546
• UniProt: P46100
• Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Reinheit: Protein A purified
• Sequenz: AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
• Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target-Kategorie: ATRX
• Antibody Type: Monoclonal Antibody

Anwendungsbeschreibung

• Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500, WB: 1 µg/ml

Bilder

Immunofluorescence staining in HeLa cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunofluorescence staining in A431 cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunofluorescence staining in MCF7 cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunofluorescence staining in U251 cell line with Anti-ATRX monoclonal antibody, showing clear nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunohistochemical staining of human glioma shows strong nuclear positivity in tumor cells.

Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts and Leydig cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATRX antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western blot analysis in human cell line A-549.

AMAb90784

AMAb90784

AMAb90784