Anti-MMP9, IgG1, Clone: [CL0538], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90804
Artikelname: Anti-MMP9, IgG1, Clone: [CL0538], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90804
Hersteller Artikelnummer: AMAb90804
Alternativnummer: ATA-AMAB90804-100,ATA-AMAB90804-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLG4B, Pan-Cancer
matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Anti-MMP9
Klonalität: Monoclonal
Konzentration: 0.1
Klon-Bezeichnung: [CL0538]
Isotyp: IgG1
NCBI: 4318
UniProt: P14780
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MMP9
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells, primarily outside germinal center.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in a subset of lymphoid cells.
Immunohistochemical staining of human lung shows strong positivity in lymphoid cells.
Immunohistochemical staining of human placenta shows strong immunoreactivity in granulocytes.
Immunohistochemical staining of human uterus shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Negative control (vector only transfected HEK293T lysate) 
Lane 3: MMP9 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401553)
AMAb90804
AMAb90804
AMAb90804