Anti-MMP9, IgG2b, Clone: [CL0542], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90806
Artikelname: |
Anti-MMP9, IgG2b, Clone: [CL0542], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB90806 |
Hersteller Artikelnummer: |
AMAb90806 |
Alternativnummer: |
ATA-AMAB90806-100,ATA-AMAB90806-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
CLG4B, Pan-Cancer |
matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL0542] |
Isotyp: |
IgG2b |
NCBI: |
4318 |
UniProt: |
P14780 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
MMP9 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:500 - 1:1000 |
|
Immunohistochemical staining of human lung shows strong immunoreactivity in the macrophages and granulocytes. |
|
Immunohistochemical staining of human spleen shows strong positivity in a subset of lymphoid cells. |
|
Immunohistochemical staining of human placenta shows strong immunoreactivity in granulocytes. |
|
Immunohistochemical staining of human duodenum shows moderate to strong positivity in a subset of lymphoid cells. |
|
Immunohistochemical staining of human uterus shows absence of immunoreactivity (negative control). |
|
AMAb90806 |
|
AMAb90806 |
|
AMAb90806 |