Anti-MMP9, IgG2b, Clone: [CL0542], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90806
Artikelname: Anti-MMP9, IgG2b, Clone: [CL0542], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90806
Hersteller Artikelnummer: AMAb90806
Alternativnummer: ATA-AMAB90806-100,ATA-AMAB90806-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLG4B, Pan-Cancer
matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Anti-MMP9
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0542]
Isotyp: IgG2b
NCBI: 4318
UniProt: P14780
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MMP9
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human lung shows strong immunoreactivity in the macrophages and granulocytes.
Immunohistochemical staining of human spleen shows strong positivity in a subset of lymphoid cells.
Immunohistochemical staining of human placenta shows strong immunoreactivity in granulocytes.
Immunohistochemical staining of human duodenum shows moderate to strong positivity in a subset of lymphoid cells.
Immunohistochemical staining of human uterus shows absence of immunoreactivity (negative control).
AMAb90806
AMAb90806
AMAb90806