Anti-EGFR, IgG1, Clone: [CL0815], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90816
Artikelname: |
Anti-EGFR, IgG1, Clone: [CL0815], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB90816 |
Hersteller Artikelnummer: |
AMAb90816 |
Alternativnummer: |
ATA-AMAB90816-100,ATA-AMAB90816-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
ERBB, ERBB1, Pan-Cancer |
epidermal growth factor receptor |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL0815] |
Isotyp: |
IgG1 |
NCBI: |
1956 |
UniProt: |
P00533 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
EGFR |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
Immunohistochemical staining of human tonsil shows moderate membranous immunoreactivity in squamous epithelial cells. |
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblast. |
|
Immunohistochemical staining of human ventricular cancer shows moderate membranous immunoreactivity in tumor cells. |
|
Lane 1: Marker [kDa] Lane 2: Human cell line A-431 |
|
|
|
AMAb90816 |
|
AMAb90816 |
|
AMAb90816 |