Anti-EGFR, IgG1, Clone: [CL0815], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90816
Artikelname: Anti-EGFR, IgG1, Clone: [CL0815], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90816
Hersteller Artikelnummer: AMAb90816
Alternativnummer: ATA-AMAB90816-100,ATA-AMAB90816-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ERBB, ERBB1, Pan-Cancer
epidermal growth factor receptor
Anti-EGFR
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL0815]
Isotyp: IgG1
NCBI: 1956
UniProt: P00533
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: EGFR
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human tonsil shows moderate membranous immunoreactivity in squamous epithelial cells.
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblast.
Immunohistochemical staining of human ventricular cancer shows moderate membranous immunoreactivity in tumor cells.
Lane 1: Marker [kDa]
Lane 2: Human cell line A-431
AMAb90816
AMAb90816
AMAb90816