Anti-THY1, IgG2b, Clone: [CL1028], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90844
Artikelname: Anti-THY1, IgG2b, Clone: [CL1028], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90844
Hersteller Artikelnummer: AMAb90844
Alternativnummer: ATA-AMAB90844-100,ATA-AMAB90844-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD90, Pan-Cancer
Thy-1 cell surface antigen
Anti-THY1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1028]
Isotyp: IgG2b
NCBI: 7070
UniProt: P04216
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: THY1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 1 µg/ml
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in neuropil.
Immunohistochemical staining of human cerebellum shows positivity in the molecular layer.
Immunohistochemical staining of human testis shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human cerebral cortex
AMAb90844
AMAb90844
AMAb90844