Anti-THY1, IgG1, Clone: [CL1040], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90846
Artikelname: Anti-THY1, IgG1, Clone: [CL1040], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90846
Hersteller Artikelnummer: AMAb90846
Alternativnummer: ATA-AMAB90846-100,ATA-AMAB90846-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD90, Pan-Cancer
Thy-1 cell surface antigen
Anti-THY1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1040]
Isotyp: IgG1
NCBI: 7070
UniProt: P04216
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: THY1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human cerebellum shows positivty in the neuropil of ganular and molecular layers.
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in neuropil.
Immunohistochemical staining of human kidney shows immunoreactivity in a subset of renal tubules.
Immunohistochemical staining of human colon shows moderate positivity in the peripheral ganglion neurons.
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human cerebral cortex
AMAb90846
AMAb90846
AMAb90846