Anti-MCL1, IgG1, Clone: [CL1128], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90859
Artikelname: Anti-MCL1, IgG1, Clone: [CL1128], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90859
Hersteller Artikelnummer: AMAb90859
Alternativnummer: ATA-AMAB90859-100,ATA-AMAB90859-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BCL2L3, Mcl-1, Pan-Cancer
myeloid cell leukemia sequence 1 (BCL2-related)
Anti-MCL1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1128]
Isotyp: IgG1
NCBI: 4170
UniProt: Q07820
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MCL1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human tonsil shows strong immunoreactivity in the reaction centrum.
Immunohistochemical staining of human breast cancer shows strong positivity in tumor cells.
Immunohistochemical staining of stomach cancer shows cytoplasmic immunoreactivity in tumor cells.
Immunohistochemical staining of lymph node in human colon shows strong positivity in the reaction centrum.
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Negative control (vector only transfected HEK293T lysate) 
Lane 3: MCL1 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411855)
AMAb90859
AMAb90859
AMAb90859