Anti-CDH1, IgG2b, Clone: [CL1170], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90862
Artikelname: Anti-CDH1, IgG2b, Clone: [CL1170], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90862
Hersteller Artikelnummer: AMAb90862
Alternativnummer: ATA-AMAB90862-100,ATA-AMAB90862-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD324, UVO, uvomorulin, Pan-Cancer
cadherin 1, type 1, E-cadherin (epithelial)
Anti-CDH1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1170]
Isotyp: IgG2b
NCBI: 999
UniProt: P12830
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CDH1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemistry analysis in human duodenum and cerebral cortex tissues using AMAb90862 antibody. Corresponding CDH1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human colorectal cancer shows moderate to strong membranous positivity in tumor cells.
Immunohistochemical staining of human cerebral cortex shows no positivity in neuronal cells as expected.
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
AMAb90862
AMAb90862
AMAb90862