Anti-CD68, IgG1, Clone: [CL1338], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90873
Artikelname: Anti-CD68, IgG1, Clone: [CL1338], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90873
Hersteller Artikelnummer: AMAb90873
Alternativnummer: ATA-AMAB90873-100,ATA-AMAB90873-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp686M18236, GP110, LAMP4, macrosialin, SCARD1, Pan-Cancer
CD68 molecule
Anti-CD68
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1338]
Isotyp: IgG1
NCBI: 968
UniProt: P34810
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD68
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemical staining of human liver shows strong immunoreactivity in Kupffer cells.
Immunohistochemical staining of human colon shows strong positivity in a subset of lymphoid cells.
Immunohistochemical staining of human tonsil shows strong immunoreactivity in single cells.
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).
AMAb90873
AMAb90873
AMAb90873