Anti-CD68, IgG1, Clone: [CL1338], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90873
Artikelname: |
Anti-CD68, IgG1, Clone: [CL1338], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB90873 |
Hersteller Artikelnummer: |
AMAb90873 |
Alternativnummer: |
ATA-AMAB90873-100,ATA-AMAB90873-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
DKFZp686M18236, GP110, LAMP4, macrosialin, SCARD1, Pan-Cancer |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL1338] |
Isotyp: |
IgG1 |
NCBI: |
968 |
UniProt: |
P34810 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
CD68 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:1000 - 1:2500 |
|
Immunohistochemical staining of human liver shows strong immunoreactivity in Kupffer cells. |
|
Immunohistochemical staining of human colon shows strong positivity in a subset of lymphoid cells. |
|
Immunohistochemical staining of human tonsil shows strong immunoreactivity in single cells. |
|
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control). |
|
AMAb90873 |
|
AMAb90873 |
|
AMAb90873 |