Anti-CD3E, IgG1, Clone: [CL1466], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90876
Artikelname: Anti-CD3E, IgG1, Clone: [CL1466], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90876
Hersteller Artikelnummer: AMAb90876
Alternativnummer: ATA-AMAB90876-100,ATA-AMAB90876-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
CD3e molecule, epsilon (CD3-TCR complex)
Anti-CD3E
Klonalität: Monoclonal
Konzentration: 0.1
Klon-Bezeichnung: [CL1466]
Isotyp: IgG1
NCBI: 916
UniProt: P07766
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD3E
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 1 µg/ml
Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using AMAb90876 antibody. Corresponding CD3E RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows strong membranous positivity, mainly in in non - germinal center cells.
Immunohistochemical staining of human small intestine shows strong membranous positivity in lymphoid cells.
Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Lane 1: Marker [kDa]
Lane 2: Human tonsil tissue lysate
AMAb90876
AMAb90876
AMAb90876